Jump to content

Leaderboard

Popular Content

Showing content with the highest reputation on 08/03/2019 in Posts

  1. 6 points
  2. Bitter Wheat starring John Malkovich was awesome. It was basically a parody of Harvey Weinstein. The name of Malkovich's character was Barney Stein, a fat movie mogul who comes to grief amid a sexual abuse scandal. If you get a chance to see Malkovich on stage, jump at it. He is a truly great stage actor. How on earth David Mammut got away with a script that even had a similar name in it is amazing.
    2 points
  3. 2 points
  4. Get your Friday on... all 80s synth - all the time. (released in 79, of course)
    2 points
  5. Celebrating Karen's birthday with an extended weekend celebration.... Last night we saw Livingston Taylor at a nice theater that is about a mile away from our Maine condo! Nice time, though I tried to get a note to him through the staff to wish her a happy bday and he didn't.... BTW, the Cowboy Junkies are coming there in October, will try and see them. Today, we're both working remotely, but we'll do a nice dinner at a restaurant by the water tonight. Then son comes up tomorrow and we'll do a couple more things. Then home Sunday; Karen is going to a play with a friend, then her mom is taking us out Sunday night to celebrate....
    2 points
  6. 2 points
  7. 2 points
  8. As proposed, I started this thread for all to share your KGSSHV Carbon build experience and to exchange Q&A. This is a natural follow up thread to the Carbon Group Buy thread. Here are the version of Gerber files used for the boards in the group buy: kgsshvcarbonv5.zip (amp board) kgsshvpssicfetdual2new.zip (GoldenReference HV power supply, all-in-one version) kgsshvpssicfetsinglenewrightfat.zip (GoldenReference HV power supply, B+ and bias) kgsshvpssicfetsinglenewleftfat.zip ( GoldenReference HV power supply, B- and 7815/7915 based +/-15V regulator) goldenreference4.zip (GoldenReference LV bipolar power supply) goldenreference4plus.zip (GoldenReference LV V+ power supply goldenreference4minus.zip (GoldenReference LV V- power supply) bias.zip (stand alone regulated Pro and Normal bias supply) I (or others) will follow up with BOM. EDIT 10/8: Updated the BOM and Mouser project for the Carbon V5 to use Vishay RN60D 174K resistors for the two 175K positions. The correct part to use is Mouser part # 71-RN60D1743F. It's a mil-spec resistor that is actually 1/2W even though it's listed as 1/4W. The previously listed Xicon is 1/4W rated and not sufficient for these positions. EDIT 10/13: Updated the BOM and Mouser project for Carbon V5 to use 3M 961102-6404-AR for the servo jumpers. Note that the BOM does not match the shared Mouser project due to parts availability at Mouser. I apologize for the errors in project/BOM. EDIT 9/10: link to shared Mouser project for the GR HV Dual. Need to add 2 LT1021-10 and missing parts not available at Mouser. Please help check for errors. http://www.mouser.com/ProjectManager/ProjectDetail.aspx?AccessID=54687aa8fa EDIT 9/12: link to shared Mouser project for the GR LV Dual. Need to add 2 LT1021-10 and your choice of insulation kits to mount uninsulated sands. Please help check for errors http://www.mouser.com/ProjectManager/ProjectDetail.aspx?AccessID=b6d687c7f7 EDIT 9/20: link to shared Mouser project for the Carbon V5 (1 channel only). Please help check for errors. http://www.mouser.com/ProjectManager/ProjectDetail.aspx?AccessID=7F837B24AA EDIT 10/19: GR HV Dual BOM in spreadsheet. More complete than the shared Mouser project above. GR HV BOM_Oct19.xls EDIT10/11: GR LV Dual BOM in spreadsheet. More complete than the shared Mouser project above. GR LV BOM_Oct 11.xls EDIT 12/11: Carbon V5 BOM (1 channel) in spreadsheet, uses KOA Speer resistors. HV Carbon V5 BOM_Dec11.xls
    1 point
  9. Here are my BOM for a pair of BH. https://www.mouser.tw/ProjectManager/ProjectDetail.aspx?AccessID=b44788bc7f for GRLV and GRHV. copied from Carbon build thread. http://www.mouser.com/ProjectManager/ProjectDetail.aspx?AccessID=b6d687c7f7 http://www.mouser.com/ProjectManager/ProjectDetail.aspx?AccessID=54687aa8fa Parts I already have or going to buy from local dealer are NOT included like LEDs, insulators, IC sockets. Someone need to check if all resistor value are correct. I hope I could finish it at the end of April
    1 point
  10. Lunch in Garda Lake, with a nice house Lombardy red. Followed by a long hike back to the car
    1 point
  11. the dht version is for the emission labs directly heated triodes. Expensive and requires 4 separate 5v filament windings on the transformer.
    1 point
  12. You can retro-fit the HV soft start circuit quite easily on earlier boards. A few here have done it successfully. PZTAx6 parts are SMD, not through-hole package. They are meant to be mount vertically on some of boards Kevin laid out. The threads are your friend, these information is all there. Read them thoroughly.
    1 point
  13. So great -- I go back and listen to those 8 albums every once in a while, but that one stands out.
    1 point
  14. Test Tone @ Home live right now: http://mixlr.com/illuminator/chat
    1 point
  15. #Rekt, as the kids say. When the vacuum cleaner arrives at the animal shelter. Vermont by moonlight. Rocky Mountain National Park. Click for slightly more gray.
    1 point
  16. This look to be a version of the GRHV without the soft-start HV feature. Look for the later Gerber files that contain a CPC1117N part. Also search the threads for the information of implementation of the HV delay.
    1 point
  17. If you can post the PCB image of the Gerber file for the PSU it would help answer your question about the HV delay. If you want plenty of headroom for the secondaries I would go with 300mA for the HV secondaries. On the Blue Hawaii, the negative rail draws much higher current (somewhere around 130mA IIRC) than the positive rail. The front end JFETs draw very little current so 200mA should be fine. Assuming the PSU boards you are targeting is what commonly known here as the GRHV, I don't think you need 360vac secondaries if you are planning for 400VDC regulated rails. 330vac should provide enough headroom for dropout voltage. It's a different story if you are using the earlier PSU that was designed for the KGSSHV.
    1 point
  18. I thought I remembered that the Duomo had some significant claims to fame. It was under continuous construction from 1387 to 1965 - a period of 578 years with a total of 65 architects in sequence. It is truly huge, with a capacity of 40,000.
    1 point
  19. At Cabo San Lucas. Picture is of lands end, the name is literal. That is where the Baja peninsula ends and the sea of Cortez meets the pacific ocean. Getting away from those areas is a must though. The other best thing besides the ocean. El pastor.
    1 point
×
×
  • Create New...

Important Information

By using this site, you agree to our Terms of Use.